PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF003300050CFD_t1
Common NameTRAES_3BF003300050CFD_c1, TRAES_3BF006500040CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 273aa    MW: 29319.8 Da    PI: 6.619
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF003300050CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3421.6e-1311102197
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              ffk+l+p +    + l+lp kfa++ + ++      tl+d++grsW v l   +  g  + ++GW++Fv   gL +g  +vF + g
  TRAES3BF003300050CFD_t1  11 FFKILLPGSFE--SSLSLPPKFAARLDRPPVL-AVATLRDPTGRSWHVGLVRHGAAGLRFDGRGWRSFVAGCGLSAGQLLVFDHLG 93 
                              78888554444..449**********988877.59***************4333333356679********************998 PP

                              SSEE..EEEEE CS
                       B3  87 rsefelvvkvf 97 
                              + +f   v  f
  TRAES3BF003300050CFD_t1  94 DLDF--AVEPF 102
                              8666..66555 PP

2B344.82.2e-141942641587
                              -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                       B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                               + l k+f+++ g  + ++ +l++  +  r+Wev +  r +s++ ++ +GW++F+ +ngL+  D++vF+  ++
  TRAES3BF003300050CFD_t1 194 YMELTKTFCARVGWAESCTAELSVAGRGDRRWEVSV--RVGSKGGMIMAGWEGFAWDNGLRISDVCVFRPADT 264
                              57799*******99999*******************..88888888899*******************96544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.1529105IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-169107IPR015300DNA-binding pseudobarrel domain
CDDcd100172.05E-1611103No hitNo description
SuperFamilySSF1019361.06E-1511109IPR015300DNA-binding pseudobarrel domain
PfamPF023622.6E-101197IPR003340B3 DNA binding domain
SMARTSM010193.3E-1011105IPR003340B3 DNA binding domain
SMARTSM010190.12186272IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-11192266IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-13193270IPR015300DNA-binding pseudobarrel domain
PfamPF023621.6E-10193267IPR003340B3 DNA binding domain
CDDcd100177.49E-7195260No hitNo description
PROSITE profilePS508639.798214273IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEGDAVLRQK FFKILLPGSF ESSLSLPPKF AARLDRPPVL AVATLRDPTG RSWHVGLVRH  60
GAAGLRFDGR GWRSFVAGCG LSAGQLLVFD HLGDLDFAVE PFDTSGCSSY FDGERGSTTN  120
IDDDDAAPDV EESGSDNHHH GRSPSRSSLP ATTGTKRRKK LSPANASPAG SCGQSSSDDG  180
ALRLGIEQPF HLQYMELTKT FCARVGWAES CTAELSVAGR GDRRWEVSVR VGSKGGMIMA  240
GWEGFAWDNG LRISDVCVFR PADTGDQVVQ AKC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RES40.0A0A077RES4_WHEAT; Uncharacterized protein
STRINGBRADI4G00380.14e-78(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP168021012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.17e-16B3 family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]